.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ue6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Mycobacterium tuberculosis single-stranded DNA-binding protein. Variability in quaternary structure and its implications. J.MOL.BIOL. 331 385-393 2003
    Site TBSGC
    PDB Id 1ue6 Target Id Rv0054
    Related PDB Ids 1ue1 1ue5 1ue7 
    Molecular Characteristics
    Source
    Alias Ids TPS9422,15607196, P0A610, 15607196, NP_214568.1 Molecular Weight 17352.11 Da.
    Residues 164 Isoelectric Point 5.12
    Sequence magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwreaaenvae sltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkasrsggfgsgsrpapaqts sasgddpwgsapasgsfgggddeppf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.295
    Matthews' coefficent 3.38 Rfactor 0.231
    Waters 229 Solvent Content 63.30

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch