.
The Open Protein Structure Annotation Network
PDB Keyword
.

1va5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mycobacterium tuberculosis Antigen 85A and 85C Structures Confirm Binding Orientation and Conserved Substrate Specificity. J.Biol.Chem. 279 36771-36777 2004
    Site TBSGC
    PDB Id 1va5 Target Id Rv0129c
    Related PDB Ids 1dqy 1dqz 
    Molecular Characteristics
    Source
    Alias Ids TPS9427,57116693, P0A4V4, 57116693, YP_177694.1 Molecular Weight 36769.33 Da.
    Residues 340 Isoelectric Point 5.92
    Sequence mtffeqvrrlrsaattlprrlaiaamgavlvyglvgtfggpatagafsrpglpveylqvpsasmgrdik vqfqgggphavylldglraqddyngwdintpafeeyyqsglsvimpvggqssfytdwyqpsqsngqnyt ykwetfltrempawlqankgvsptgnaavglsmsggsalilaayypqqfpyaaslsgflnpsegwwptl iglamndsggynansmwgpssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegl tlrtnqtfrdtyaadggrngvfnfppngthswpywneqlvamkadiqhvlngatppaapaapaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.02 Rfree 0.211
    Matthews' coefficent 2.66 Rfactor 0.187
    Waters 252 Solvent Content 53.39

    Ligand Information
    Ligands SOG (2-HYDROXYMETHYL-6-OCTYLSULFANYL-TETRAHYDRO-PYRAN-3,4,) x 4
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch