.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xxo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase at 1.8 a resolution. To be Published
    Site TBSGC
    PDB Id 1xxo Target Id Rv1155
    Related PDB Ids 2aq6 1w9a 1y30 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS9448,15608295, O06553, 15608295, NP_215671.1 Molecular Weight 16299.58 Da.
    Residues 147 Isoelectric Point 6.05
    Sequence marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrdprasi lvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqamvtdrrvlltlpish vyglppgmr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.231
    Matthews' coefficent 2.10 Rfactor 0.183
    Waters 323 Solvent Content 41.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch