The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of AhpE from Mycobacterium tuberculosis, a 1-Cys Peroxiredoxin. J.Mol.Biol. 346 1035-1046 2005
    Site TBSGC
    PDB Id 1xxu Target Id Rv2238c
    Related PDB Ids 1xvw 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20678,15609375, P65688, 15609375, NP_216754.1 Molecular Weight 16818.13 Da.
    Residues 153 Isoelectric Point 5.24
    Sequence mlnvgatapdftlrdqnqqlvtlrgyrgaknvllvffplaftgicqgeldqlrdhlpefenddsaalai svgpppthkiwatqsgftfpllsdfwphgavsqaygvfneqagianrgtfvvdrsgiirfaemkqpgev rdqrlwtdalaalta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.286
    Matthews' coefficent 2.80 Rfactor 0.242
    Waters 188 Solvent Content 55.10

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch