The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the inactive variant C60S of Mycobacterium tuberculosis thiol peroxidase. Acta Crystallogr.,Sect.D 62 563-567 2006
    Site TBSGC
    PDB Id 1y25 Target Id Rv1932
    Related PDB Ids 1xvq 
    Molecular Characteristics
    Alias Ids TPS20665,15609069, P66952, 15609069, NP_216448.1 Molecular Weight 16895.12 Da.
    Residues 165 Isoelectric Point 4.37
    Sequence maqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvcatsvrtfde raaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtiadgpmagllaraivvigad gnvaytelvpeiaqepnyeaalaalga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2493
    Matthews' coefficent 3.14 Rfactor 0.17076
    Waters 368 Solvent Content 60.78

    Ligand Information
    Ligands ACT (ACETATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch