The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of Mycobacterium tuberculosispyridoxine 5'-phosphate oxidase and its complexes with flavin mononucleotide and pyridoxal 5'-phosphate. Acta Crystallogr.,Sect.D 61 1492-1499 2005
    Site TBSGC
    PDB Id 1y30 Target Id Rv1155
    Related PDB Ids 1xxo 2aq6 1w9a 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS9450,15608295, O06553, 15608295, NP_215671.1 Molecular Weight 16299.58 Da.
    Residues 147 Isoelectric Point 6.05
    Sequence marqvfddkllavisgnsigvlatikhdgrpqlsnvqyhfdprklliqvsiaepraktrnlrrdprasi lvdaddgwsyavaegtaqltppaaapdddtvealialyrniagehsdwddyrqamvtdrrvlltlpish vyglppgmr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.268
    Matthews' coefficent 2.11 Rfactor 0.195
    Waters 227 Solvent Content 41.30

    Ligand Information
    Ligands FMN (FLAVIN) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch