.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y3i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NAD-binding mode and the significance of intersubunit contact revealed by the crystal structure of Mycobacterium tuberculosis NAD kinase-NAD complex. Biochem.Biophys.Res.Commun. 327 500-508 2005
    Site TBSGC
    PDB Id 1y3i Target Id Rv1695
    Related PDB Ids 1u0r 1u0t 1y3h 
    Molecular Characteristics
    Source
    Alias Ids TPS20532,15608833, P0A5S6, 15608833, O33196, NP_216211.1 Molecular Weight 32901.84 Da.
    Residues 307 Isoelectric Point 5.26
    Sequence mtahrsvllvvhtgrdeatetarrvekvlgdnkialrvlsaeavdrgslhlapddmramgveievvdad qhaadgcelvlvlggdgtflraaelarnasipvlgvnlgrigflaeaeaeaidavlehvvaqdyrvedr ltldvvvrqggrivnrgwalnevslekgprlgvlgvvveidgrpvsafgcdgvlvstptgstayafsag gpvlwpdleailvvpnnahalfgrpmvtspeatiaieieadghdalvfcdgrremlipagsrlevtrcv tsvkwarldsapftdrlvrkfrlpvtgwrgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.215
    Matthews' coefficent 2.79 Rfactor
    Waters 43 Solvent Content 55.50

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2;GOL (GLYCEROL) x 4;SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch