The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Possible role for HtrA homologs in mycobacterium tuberculosis. To be Published
    Site TBSGC
    PDB Id 1y8t Target Id Rv0983
    Molecular Characteristics
    Alias Ids TPS9447,15608123, O53896, 15608123, O53896, NP_215498.1 Molecular Weight 46449.91 Da.
    Residues 464 Isoelectric Point 5.98
    Sequence maklarvvglvqeeqpsdmtnhpryspppqqpgtpgyaqgqqqtysqqfdwryppspppqptqyrqpye alggtrpglipgviptmtpppgmvrqrpragmlaigavtiavvsagiggaaaslvgfnrapagpsggpv aasaapsipaanmppgsveqvaakvvpsvvmletdlgrqseegsgiilsaegliltnnhviaaaakppl gspppkttvtfsdgrtapftvvgadptsdiavvrvqgvsgltpislgsssdlrvgqpvlaigsplgleg tvttgivsalnrpvsttgeagnqntvldaiqtdaainpgnsggalvnmnaqlvgvnsaiatlgadsada qsgsiglgfaipvdqakriadelistgkashaslgvqvtndkdtlgakivevvaggaaanagvpkgvvv tkvddrpinsadalvaavrskapgatvaltfqdpsggsrtvqvtlgkaeq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.28027
    Matthews' coefficent 2.36 Rfactor 0.22652
    Waters 318 Solvent Content 47.85

    Ligand Information



    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch