.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yk3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of Rv1347c, a putative antibiotic resistance protein from Mycobacterium tuberculosis, reveals a GCN5-related fold and suggests an alternative function in siderophore biosynthesis. J.Biol.Chem. 280 13978-13986 2005
    Site TBSGC
    PDB Id 1yk3 Target Id Rv1347c
    Molecular Characteristics
    Source
    Alias Ids TPS9455,15608487, P64819, NP_215863.1 Molecular Weight 23797.67 Da.
    Residues 210 Isoelectric Point 6.38
    Sequence mtkptsagqaddalvrlarerfdlpdqvrrlarppvpsleppyglrvaqltdaemlaewmnrphlaaaw eydwpasrwrqhlnaqlegtyslpligswhgtdggylelywaakdlishyydadpydlglhaaiadlsk vnrgfgplllprivasvfaneprcrrimfdpdhrntatrrlcewagckflgehdttnrrmalyaleapt taa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.20 Rfree 0.258
    Matthews' coefficent 2.40 Rfactor 0.227
    Waters 650 Solvent Content 51.00

    Ligand Information
    Ligands BOG (B-OCTYLGLUCOSIDE) x 3
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch