.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yl7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms. Acta Crystallogr.,Sect.D 66 61-72 2010
    Site TBSGC
    PDB Id 1yl7 Target Id Rv2773c
    Related PDB Ids 1c3v 1p9l 1yl5 1yl6 
    Molecular Characteristics
    Source
    Alias Ids TPS12011,15609910, P72024, 15609910, NP_217289.1 Molecular Weight 25731.92 Da.
    Residues 245 Isoelectric Point 5.51
    Sequence mrvgvlgakgkvgatmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmgnleflidng ihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaarffdsaevielhhphkad apsgtaartakliaearkglppnpdatstslpgargadvdgipvhavrlaglvahqevlfgtegetlti rhdsldrtsfvpgvllavrriaerpgltvgleplldlh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.34 Rfree 0.2381
    Matthews' coefficent 2.70 Rfactor 0.18134
    Waters 356 Solvent Content 54.00

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 8
    Metals MG (MAGNESIUM) x 6

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch