.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z6k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure and computational analysis of Mycobacterium tuberculosis protein CitE suggest a novel enzymatic function. J.Mol.Biol. 365 275-283 2007
    Site TBSGC
    PDB Id 1z6k Target Id Rv2498c
    Related PDB Ids 1u5h 1u5v 
    Molecular Characteristics
    Source
    Alias Ids TPS20688,15609635, O06162, 15609635, NP_217014.1 Molecular Weight 28884.03 Da.
    Residues 273 Isoelectric Point 5.27
    Sequence mnlraagpgwlfcpadrperfakaaaaadvvildledgvaeaqkpaarnalrdtpldpertvvrinagg tadqardlealagtayttvmlpkaesaaqvielaprdvialvetargavcaaeiaaadptvgmmwgaed liatlggsssrradgayrdvarhvrstillaasafgrlaldavhldildveglqeeardaaavgfdvtv cihpsqipvvrkayrpsheklawarrvlaasrsergafafegqmvdspvlthaetmlrrageatse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.256
    Matthews' coefficent 3.01 Rfactor 0.224
    Waters 71 Solvent Content 58.80

    Ligand Information
    Ligands OAA (OXALOACETATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch