.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z9w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Regulation by oligomerization in a mycobacterial folate biosynthetic enzyme. J.Mol.Biol. 349 61-72 2005
    Site TBSGC
    PDB Id 1z9w Target Id Rv3607c
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20733, Molecular Weight 14349.42 Da.
    Residues 131 Isoelectric Point 5.83
    Sequence adrielrgltvhgrhgvydhervagqrfvidvtvwidlaeaansddladtydyvrlasraaeivagpprk lietvgaeidhvmddqrvhavevavhkpqapipqtfddvavvirrsrrggrgwvvpaggav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.23429
    Matthews' coefficent 1.73 Rfactor 0.17854
    Waters 25 Solvent Content 29.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch