.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zlk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of Mycobacterium tuberculosis DosR and DosR-DNA complex involved in gene activation during adaptation to hypoxic latency. J.Mol.Biol. 354 630-641 2005
    Site TBSGC
    PDB Id 1zlk Target Id Rv3133c
    Related PDB Ids 1zlj 
    Molecular Characteristics
    Source
    Alias Ids TPS27444,15610269, P95193, 15610269, P95193, NP_217649.1 Molecular Weight 23292.62 Da.
    Residues 217 Isoelectric Point 5.61
    Sequence mvkvflvddhevvrrglvdllgadpeldvvgeagsvaeamarvpaarpdvavldvrlpdgngielcrdl lsrmpdlrcliltsytsdeamldailagasgyvvkdikgmelaravkdvgagrslldnraaaalmaklr gaaekqdplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfatel krsrppgdgp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.10 Rfree 0.28802
    Matthews' coefficent 2.97 Rfactor 0.27154
    Waters Solvent Content 58.64

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch