.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a2j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative pyridoxine 5'-phosphate oxidase (Rv2607) from Mycobacterium tuberculosis. Proteins 62 563-569 2005
    Site TBSGC
    PDB Id 2a2j Target Id Rv2607
    Molecular Characteristics
    Source
    Alias Ids TPS20694,15609744, P65682, 15609744, NP_217123.1 Molecular Weight 25185.01 Da.
    Residues 224 Isoelectric Point 5.51
    Sequence mdddaqmvaidkdqlarmrgeygpekdgcgdldfdwlddgwltllrrwlndaqragvsepnamvlatva dgkpvtrsvlckildesgvafftsytsakgeqlavtpyasatfpwyqlgrqahvqgpvskvsteeifty wsmrprgaqlgawasqqsrpvgsraqldnqlaevtrrfadqdqipvppgwggyriapeivefwqgrenr mhnrirvangrlerlqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.26018
    Matthews' coefficent 2.69 Rfactor 0.20918
    Waters 75 Solvent Content 53.90

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch