.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a7y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the conserved hypothetical protein Rv2302 from Mycobacterium tuberculosis. J.Bacteriol. 188 5993-6001 2006
    Site TBSGC
    PDB Id 2a7y Target Id Rv2302
    Molecular Characteristics
    Source
    Alias Ids TPS20684,15609439, P64983, NP_216818.1 Molecular Weight 8590.08 Da.
    Residues 80 Isoelectric Point 6.02
    Sequence mhakvgdylvvkgttterhdqhaeiievrsadgsppyvvrwlvnghettvypgsdavvvtatehaeaek raaaraghaat
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch