The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Probing the Mechanism of the Mycobacterium tuberculosis beta-Ketoacyl-Acyl Carrier Protein Synthase III mtFabH: Factors Influencing Catalysis And Substrate Specificity. J.Biol.Chem. 280 32539-32547 2005
    Site TBSGC
    PDB Id 2aj9 Target Id Rv0533c
    Related PDB Ids 1hzp 1m1m 2ahb 
    Molecular Characteristics
    Alias Ids TPS9438,15607673, P0A574, 15607673, NP_215047.1 Molecular Weight 34870.46 Da.
    Residues 335 Isoelectric Point 4.98
    Sequence mteiattsgarsvgllsvgayrpervvtndeicqhidssdewiytrtgiktrrfaaddesaasmateac rralsnaglsaadidgvivttnthflqtppaapmvaaslgakgilgfdlsagcagfgyalgaaadmirg ggaatmlvvgteklsptidmydrgncfifadgaaavvvgetpfqgigptvagsdgeqadairqdidwit faqnpsgprpfvrlegpavfrwaafkmgdvgrramdaagvrpdqidvfvphqansrinellvknlqlrp davvandiehtgntsaasiplamaellttgaakpgdlalligygaglsyaaqvvrmpkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.279
    Matthews' coefficent 2.30 Rfactor 0.225
    Waters 101 Solvent Content 45.30

    Ligand Information



    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch