.
The Open Protein Structure Annotation Network
PDB Keyword
.

2asf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The molecular structure of Rv2074, a probable pyridoxine 5'-phosphate oxidase from Mycobacterium tuberculosis, at 1.6 angstroms resolution. Acta Crystallogr.,Sect.F 62 735-742 2006
    Site TBSGC
    PDB Id 2asf Target Id Rv2074
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20669,15609211, Q10682, 15609211, NP_216590.1 Molecular Weight 15023.20 Da.
    Residues 137 Isoelectric Point 9.50
    Sequence mamvntttrlsddalaflserhlamlttlradnsphvvavgftfdpkthiarvittggsqkavnadrsg lavlsqvdgarwlslegraavnsdidavrdaelryaqryrtprpnprrvvievqiervlgsadlldra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.20397
    Matthews' coefficent 2.00 Rfactor 0.17866
    Waters 175 Solvent Content 38.40

    Ligand Information
    Ligands CIT (CITRIC) x 2
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch