The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a Mycobacterium tuberculosis NusA-RNA complex. Embo J. 24 3576-3587 2005
    Site TBSGC
    PDB Id 2atw Target Id Rv2841c
    Related PDB Ids 1k0r 2asb 
    Molecular Characteristics
    Alias Ids TPS20702,15609978, P0A5M2, 15609978, NP_217357.1 Molecular Weight 37639.52 Da.
    Residues 347 Isoelectric Point 6.42
    Sequence mnidmaalhaievdrgisvnelletiksalltayrhtqghqtdarieidrktgvvrviaretdeagnli sewddtpegfgriaattarqvmlqrfrdaenertygefstregeivagviqrdsranarglvvvrigte tkasegvipaaeqvpgesyehgnrlrcyvvgvtrgareplitlsrthpnlvrklfslevpeiadgsvei vavareaghrskiavrsnvaglnakgacigpmgqrvrnvmselsgekidiidydddparfvanalspak vvsvsvidqtaraarvvvpdfqlslaigkegqnarlaarltgwridirgdapppppgqpepgvsrgmahdr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.27267
    Matthews' coefficent 2.34 Rfactor 0.20599
    Waters 208 Solvent Content 46.90

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch