The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Mycobacterium Tuberculosis Dihydrofolate Reductase is a Target for Isoniazid. Nat.Struct.Mol.Biol. 13 408 2006
    Site TBSGC
    PDB Id 2cig Target Id Rv2763c
    Related PDB Ids 1dg8 1dg7 1dg5 1df7 
    Molecular Characteristics
    Alias Ids TPS27467,15609900, P0A546, 15609900, NP_217279.1 Molecular Weight 17639.09 Da.
    Residues 159 Isoelectric Point 6.30
    Sequence mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgrrnvvlsrqa dfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglpreagdalapvldetwrge tgewrfsrsglryrlysyhrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.9 Rfree 0.212
    Matthews' coefficent 2.64 Rfactor 0.178
    Waters 137 Solvent Content 53.10

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch