The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The molecular structure of epoxide hydrolase B from Mycobacterium tuberculosis and its complex with a urea-based inhibitor. J.Mol.Biol. 381 897-912 2008
    Site TBSGC
    PDB Id 2e3j Target Id Rv1938
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS27350,15609075, P95276, 15609075, NP_216454.1 Molecular Weight 39295.31 Da.
    Residues 356 Isoelectric Point 5.05
    Sequence msqvhrilncrgtrihavadsppdqqgplvvllhgfpeswyswrhqipalagagyrvvaidqrgygrss kyrvqkayrikelvgdvvgvldsygaeqafvvghdwgapvawtfawlhpdrcagvvgisvpfagrgvig lpgspfgerrpsdyhlelagpgrvwyqdyfavqdgiiteieedlrgwllgltytvsgegmmaatkaavd agvdlesmdpidviragplcmaegarlkdafvypetmpawfteadldfytgefersgfggplsfyhnid ndwhdladqqgkpltppalfiggqydvgtiwgaqaierahevmpnyrgthmiadvghwiqqeapeetnr llldflgglrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.276
    Matthews' coefficent 2.19 Rfactor 0.235
    Waters 128 Solvent Content 43.89

    Ligand Information
    Ligands ACT (ACETATE) x 9



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch