.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fgg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Rv2632c. To be Published
    Site TBSGC
    PDB Id 2fgg Target Id Rv2632c
    Molecular Characteristics
    Source
    Alias Ids TPS20696,15609769, P65033, NP_217148.1 Molecular Weight 10082.71 Da.
    Residues 93 Isoelectric Point 4.98
    Sequence mtdsehvgktcqidvlieehdertrakarlswagrqmvgvglarldpadepvaqigdelaiaralsdla nqlfaltssdieasthqpvtglhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.26481
    Matthews' coefficent 2.40 Rfactor 0.22444
    Waters 14 Solvent Content 53.66

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch