.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fr2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Rv2717c from Mycobacterium tuberculosis. To be Published
    Site TBSGC
    PDB Id 2fr2 Target Id Rv2717c
    Molecular Characteristics
    Source
    Alias Ids TPS20698,15609854, O07216, NP_217233.1 Molecular Weight 17845.33 Da.
    Residues 164 Isoelectric Point 5.94
    Sequence mtrdlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravadgkplhsetg ylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglaptakevtaldrsyridgde lsyslqmravgqplqdhlaavlhrqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.20172
    Matthews' coefficent 2.52 Rfactor 0.17891
    Waters 159 Solvent Content 51.21

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch