.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fvh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Rv1848, a Urease Gamma Subunit UreA (Urea amidohydrolase), from Mycobacterium Tuberculosis. To be Published
    Site TBSGC
    PDB Id 2fvh Target Id Rv1848
    Molecular Characteristics
    Source
    Alias Ids TPS20535,15608985, P0A676, 15608985, NP_216364.1 Molecular Weight 11089.13 Da.
    Residues 100 Isoelectric Point 5.78
    Sequence mrltpheqerlllsyaaelarrrrarglrlnhpeaiaviadhilegardgrtvaelmasgrevlgrddv megvpemlaevqveatfpdgtklvtvhqpia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.80 Rfree 0.22946
    Matthews' coefficent 1.80 Rfactor 0.18382
    Waters 164 Solvent Content 31.76

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch