.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g2d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative pduO-type ATP:cobalamin adenosyltransferase from Mycobacterium tuberculosis. To be Published
    Site TBSGC
    PDB Id 2g2d Target Id Rv1314c
    Molecular Characteristics
    Source
    Alias Ids TPS9453,15608454, P64803, 15608454, NP_215830.1 Molecular Weight 20693.16 Da.
    Residues 193 Isoelectric Point 5.68
    Sequence mavhltriytrtgddgttglsdmsrvaktdarlvayadcdeanaaigaalalghpdtqitdvlrqiqnd lfdagadlstpivenpkhpplriaqsyidrlegwcdaynaglpalksfvlpggsplsallhvartvvrr aersawaavdahpegvsvlpakylnrlsdllfilsrvanpdgdvlwrpggdrtas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.228
    Matthews' coefficent 2.28 Rfactor 0.194
    Waters 79 Solvent Content 45.95

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch