.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gln

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Ligand interactions in the distal heme pocket of Mycobacterium tuberculosis truncated hemoglobin N: roles of TyrB10 and GlnE11 residues. Biochemistry 45 8770-8781 2006
    Site TBSGC
    PDB Id 2gln Target Id Rv1542C
    Related PDB Ids 1idr 1s56 1s61 1rte 2gkm 2gkn 2gl3 
    Molecular Characteristics
    Source
    Alias Ids TPS27463,15608680, P0A592, 15608680, Q10784, NP_216058.1 Molecular Weight 14447.77 Da.
    Residues 136 Isoelectric Point 5.66
    Sequence mgllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqveffaaalggp epytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviaplavdvtsgesttapv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.98 Rfree 0.23345
    Matthews' coefficent 2.11 Rfactor 0.1733
    Waters 191 Solvent Content 41.67

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;CYN-HEM (CYANIDE) x 2
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch