The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray Crystal Structure of Mycobacterium tuberculosis beta-Ketoacyl Acyl Carrier Protein Synthase II (mtKasB). J.Mol.Biol. 366 469-480 2007
    Site TBSGC
    PDB Id 2gp6 Target Id Rv2246
    Molecular Characteristics
    Alias Ids TPS20681,15609383, P63456, P63456, NP_216762.1 Molecular Weight 46418.15 Da.
    Residues 438 Isoelectric Point 5.29
    Sequence mgvpplagasrtdmegtfarpmtelvtgkafpyvvvtgiamttalatdaettwkllldrqsgirtlddp fveefdlpvrigghlleefdhqltrielrrmgylqrmstvlsrrlwenagspevdtnrlmvsigtglgs aeelvfsyddmrargmkavspltvqkympngaaaavglerhakagvmtpvsacasgaeaiarawqqivl geadaaicggvetrieavpiagfaqmrivmstnnddpagacrpfdrdrdgfvfgeggalllieteehak arganilarimgasitsdgfhmvapdpngeraghaitraiqlaglapgdidhvnahatgtqvgdlaegr ainnalggnrpavyapksalghsvgavgavesiltvlalrdqvipptlnlvnldpeidldvvageprpg nyryainnsfgfgghnvaiafgry
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.232
    Matthews' coefficent 2.95 Rfactor 0.177
    Waters 229 Solvent Content 58.37

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch