.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i6y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and mechanism of MbtI, the salicylate synthase from Mycobacterium tuberculosis. Biochemistry 46 954-964 2007
    Site TBSGC
    PDB Id 2i6y Target Id Rv2386c
    Related PDB Ids 2g5f 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20686,57116981, Q7D785, 57116981, Q7D785, YP_177877.1 Molecular Weight 48751.52 Da.
    Residues 450 Isoelectric Point 5.21
    Sequence mselsvatgavstasssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaagvqamveldsd elrvirdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhryglqqrlaphtplarvfspr trimvsekeirlfdagirhreaidrllatgvrevpqsrsvdvsddpsgfrrrvavavdeiaagryhkvi lsrcvevpfaidfpltyrlgrrhntpvrsfllqlggiralgyspelvtavradgvviteplagtralgr gpaidrlarddlesnskeivehaisvrssleeitdiaepgsaavidfmtvrergsvqhlgstirarldp ssdrmaalealfpavtasgipkaagveaifrldecprglysgavvmlsadggldaaltlraayqvggrt wlragagiieeseperefeetceklstltpylvarq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.294
    Matthews' coefficent 2.15 Rfactor 0.232
    Waters 3 Solvent Content 42.74

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch