The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Mycobacterium tuberculosis P450 CYP121-fluconazole complex reveals new azole drug-P450 binding mode. J.Biol.Chem. 281 39437-39443 2006
    Site TBSGC
    PDB Id 2ij7 Target Id Rv2276
    Related PDB Ids 1n40 1n4g 
    Molecular Characteristics
    Alias Ids TPS27439,15609413, P0A514, 15609413, Q59571, NP_216792.1 Molecular Weight 43253.48 Da.
    Residues 396 Isoelectric Point 6.21
    Sequence mtatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsmketaaag aprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslldnlitegapadlrndfa dplatalhckvlgipqedgpklfrslsiafmssadpipaakinwdrdieymagilenpnittglmgels rlrkdpayshvsdelfatigvtffgagvistgsflttalisliqrpqlrnllhekpelipagveellri nlsfadglprlatadiqvgdvlvrkgelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfc pgsalgrrhaqigieallkkmpgvdlavpidqlvwrtrfqrriperlpvlw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.90 Rfree 0.22644
    Matthews' coefficent 2.46 Rfactor 0.16736
    Waters 1982 Solvent Content 49.92

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch