.
The Open Protein Structure Annotation Network
PDB Keyword
.

2in9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystallographic and mutational studies of Mycobacterium tuberculosis recA mini-inteins suggest a pivotal role for a highly conserved aspartate residue. J.Mol.Biol. 367 162-173 2007
    Site TBSGC
    PDB Id 2in9 Target Id Rv2737c
    Related PDB Ids 1g19 1g18 1mo3 1mo4 1mo5 1mo6 2imz 2in0 2in8 
    Molecular Characteristics
    Source
    Alias Ids TPS20700,15609874, P0A5U4, 15609874, NP_217253.1 Molecular Weight 85384.39 Da.
    Residues 790 Isoelectric Point 6.01
    Sequence mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprgrvieiygpe ssgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqpdtgeqaleiadmlirsga ldivvidsvaalvpraelegemgdshvglqarlmsqalrkmtgalnnsgttaifinqlrdkigvmfgsp etttggkalkfyasvrmdvrrvetlkdgtnavgnrtrvkvvknkclaegtrifdpvtgtthriedvvdg rkpihvvaaakdgtlharpvvswfdqgtrdviglriaggaivwatpdhkvlteygwraagelrkgdrva qprrfdgfgdsapipadharllgyligdgrdgwvggktpinfinvqraliddvtriaatlgcaahpqgr islaiahrpgerngvadlcqqagiygklawektipnwffepdiaadivgnllfglfesdgwvsreqtga lrvgytttseqlahqihwlllrfgvgstvrdydptqkrpsivngrriqskrqvfevrisgmdnvtafae svpmwgprgaaliqaipeatqgrrrgsqatylaaemtdavlnyldergvtaqeaaamigvasgdprggm kqvlgasrlrrdrvqaladalddkflhdmlaeelrysvirevlptrrartfdleveelhtlvaegvvvh ncsppfkqaefdilygkgisregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadvade iekkikeklgigavvtddpsndgvlpapvdf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.285
    Matthews' coefficent 1.89 Rfactor 0.236
    Waters 95 Solvent Content 34.97

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch