The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Molecular Structure of Rv1873, a Conserved Hypothetical Protein from Mycobacterium Tuberculosis, at 1.38A Resolution. Acta Crystallogr.,Sect.F 62 1201 2006
    Site TBSGC
    PDB Id 2jek Target Id Rv1873
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20539,15609010, O07756, NP_216389.1 Molecular Weight 16206.67 Da.
    Residues 145 Isoelectric Point 7.80
    Sequence mksasdpfdlkrfvyaqapvyrsvveelragrkrghwmwfvfpqlrglgssplavrygissleeaqayl qhdllgprlhectglvnqvqgrsieeifgppddlklcssmtlfaratdanqdfvallakyygggedrrt vallavt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.38 Rfree 0.200
    Matthews' coefficent 1.77 Rfactor 0.167
    Waters 161 Solvent Content 30.7

    Ligand Information
    Ligands SO4 (SULFATE) x 1;GOL (GLYCEROL) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch