.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nqt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of N-acetyl-gamma-glutamyl-phosphate Reductase from Mycobacterium tuberculosis in Complex with NADP(+). J.Mol.Biol. 367 1357-1369 2007
    Site TBSGC
    PDB Id 2nqt Target Id Rv1652
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20485, Molecular Weight 35722.45 Da.
    Residues 347 Isoelectric Point 6.18
    Sequence qnrqvanatkvavagasgyaggeilrlllghpayadgrlrigaltaatsagstlgehhphltplahrvve pteaavlggdavflalphghsavlaqqlspetliidcgadfrltdaavwerfygsshagswpyglpelp gardqlrgtrriavpgcypaallalfpalaadliepavtvvavsgtsgagraattdllgaevigsaray niagvhrhtpeiaqglravtdrdvsvsftvlipasrgilatctartrsplsqlraayekayhaepfiyl mpegqlprtgavigsnaahiavavdedaqtfvaiaaidnvkgtagaavqsmnlalgwpetdglsvvgvap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.58 Rfree 0.18531
    Matthews' coefficent 2.63 Rfactor 0.16307
    Waters 874 Solvent Content 53.32

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch