The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structures of ornithine carbamoyltransferase from Mycobacterium tuberculosis and its ternary complex with carbamoyl phosphate and L-norvaline reveal the enzyme's catalytic mechanism. J.Mol.Biol. 375 1052-1063 2008
    Site TBSGC
    PDB Id 2p2g Target Id Rv1656
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS20492, Molecular Weight 32580.84 Da.
    Residues 303 Isoelectric Point 5.28
    Sequence irhflrdddlspaeqaevlelaaelkkdpvsrrplqgprgvavifdknstrtrfsfelgiaqlgghavvv dsgstqlgretlqdtakvlsryvdaivwrtfgqerldamasvatvpvinalsdefhpcqvladlqtiae rkgalrglrlsyfgdgannahslllggvtagihvtvaapegflpdpsvraaaerraqdtgasvtvtada haaaagadvlvtdtwtsmgqendgldrvkfrpfqlnsrllaladsdaivlhclpahrgdeitdavmdgp asavwdeaenrlhaqkallvwllers
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.70 Rfree 0.25903
    Matthews' coefficent 2.71 Rfactor 0.20172
    Waters 140 Solvent Content 54.59

    Ligand Information
    Ligands SO4 (SULFATE) x 16



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch