.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s8n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis. Structure 12 1595-1605 2004
    Site TBSGC
    PDB Id 1s8n Target Id Rv1626
    Related PDB Ids 1sd5 
    Molecular Characteristics
    Source
    Alias Ids TPS12003,15608764, O06143, 15608764, O06143, NP_216142.1 Molecular Weight 22667.85 Da.
    Residues 205 Isoelectric Point 5.02
    Sequence mtgpttdadaavprrvliaedealirmdlaemlreegyeivgeagdgqeavelaelhkpdlvimdvkmp rrdgidaaseiaskriapivvltafsqrdlverardagamaylvkpfsisdlipaielavsrfreital egevatlserletrklverakgllqtkhgmtepdafkwiqraamdrrttmkrvaevvletlgtpkdt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.48 Rfree 0.22835
    Matthews' coefficent 2.00 Rfactor 0.2029
    Waters 201 Solvent Content 38.48

    Ligand Information
    Ligands AZI (AZIDE) x 1
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch