The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ATP binding domain of Hidtidine Kinase from MTB. To be Published
    Site XMTB
    PDB Id 1ys3 Target Id rv0902c
    Related PDB Ids 1ysr 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS12001, Molecular Weight 47826.50 Da.
    Residues 446 Isoelectric Point 5.72
    Sequence mnilsrifartpslrtrvvvataigaaipvlivgtvvwvgitndrkerldrrldeaagfaipfvprgld eiprspndqdalitvrrgnviksnsditlpklqddyadtyvrgvryrvrtveipgpeptsvavgatyda tvaetnnlhrrvllictfaigaaavfawllaafavrpfkqlaeqtrsidagdeaprvevhgaseaieia eamrgmlqriwneqnrtkealasardfaavsshelrtpltamrtnlevlstldlpddqrkevlndvirt qsrieatlsalerlaqgelstsddhvpvditdlldraahdaariypdldvslvpsptciivglpaglrl avdnaianavkhggatlvqlsavssragveiaiddngsgvpegerqvvferfsrgstashsgsglglal vaqqaqlhggtaslensplggarlvlrlpgps
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.23523
    Matthews' coefficent 2.50 Rfactor 0.18596
    Waters 206 Solvent Content 51.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch