The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the response regulator protein prrA comlexed with Mg2+'. To be published
    Site XMTB
    PDB Id 1ys7 Target Id rv0903c
    Related PDB Ids 1ys6 
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS12006, Molecular Weight 25252.48 Da.
    Residues 236 Isoelectric Point 4.97
    Sequence mggmdtgvtsprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrrgstatssse titvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllelvwgydfaadtnvvdvfi gylrrkleagggprllhtvrgvgfvlrmq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.58 Rfree 0.22996
    Matthews' coefficent 2.18 Rfactor 0.18653
    Waters 191 Solvent Content 43.51

    Ligand Information
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch