.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bzr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Diversity in the Six-Fold Redundant Set of Acyl-Coa Carboxyltransferases in Mycobacterium Tuberculosis. FEBS Lett. 580 6898 2006
    Site XMTB
    PDB Id 2bzr Target Id rv3280
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS12015, Molecular Weight 59350.97 Da.
    Residues 548 Isoelectric Point 5.19
    Sequence mtsvtdrsahsaerstehtidihttagklaelhkrreeslhpvgedavekvhakgkltareriyallde dsfveldalakhrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqel aiktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvyspaltdfvim vdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdafdyvrellsylppnnstd apryqaaaptgpieenltdedleldtlipdspnqpydmhevitrllddefleiqagyaqnivvgfgrid grpvgivanqpthfagcldinasekaarfvrtcdcfnipivmlvdvpgflpgtdqeyngiirrgaklly aygeatvpkitvitrkayggaycvmgskdmgcdvnlawptaqiavmgasgavgfvyrqqlaeaaanged idklrlrlqqeyedtlvnpyvaaergyvdavippshtrgyigtalrllerkiaqlppkkhgnvpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.211
    Matthews' coefficent 3.66 Rfactor 0.176
    Waters 1690 Solvent Content 66.15

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch