.
The Open Protein Structure Annotation Network
PDB Keyword
.

2cbk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site XMTB
    PDB Id 2cbk Target Id rv2018
    Molecular Characteristics
    Source Mycobacterium tuberculosis h37rv
    Alias Ids TPS11999, Molecular Weight 26033.03 Da.
    Residues 239 Isoelectric Point 5.09
    Sequence magdqelelrfdvplytlaeasrylvvpratlatwadgyerrpanapavqgqpiitalphptgsharlp fvgiaeayvlnafrragvpmqrirpsldwliknvgphalasqdlctdgaevlwrfaersgegspddlvv rglivprsgqyvfkeivehylqqisfaddnlasmirlpqygdanvvldprrgygqpvfdgsgvrvadvl gplragatfqavaddygvtpdqlrdaldaiaa
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch