.
The Open Protein Structure Annotation Network
PDB Keyword
.

NYSGXRC-9572c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site YSG
    Status Crystallized
    Target Id NYSGXRC-9572c
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS32234,NP_459493, PF00122 TM0498 Molecular Weight 87905.17 Da.
    Residues 833 Isoelectric Point 5.49
    Sequence msqtidltldglscghcvkrvkesleqrpdveladvtvteahvtgtasadalietikqagygatlshpka kpltessipsealaavphelpvatadeesqqlllsgmscascvtrvqhalqsvpgvtqarvnlaertal vmgsasaadlvqavekagygaeaieddikrrerqqetaiatmkrfrwqaivalavgipvmvwgmigdnm mvtddnrslwlaiglitlavmvfagghfyrnawksllngtatmdtlvalgtgvawlysmsvnlwpqwfp mearhlyyeasamiiglinlghmleararqrsskaleklldltpptarvvtedgeksvpladvqpgmll rlttgdrvpvdgeitqgeawldeamltgepipqqkgegdsvhagtvvqdgsvlfrasavgshttlsrii rmvrqaqsskpeigqladkisavfvpvvvaialfsaaiwyffgpapqivytlviattvliiacpcalgl atpmsiisgvgraaefgvlvrdadalqrastldtlvfdktgtltegkpqvvaiktfngveeaqalrlaa aleqgsshplahailekagddklpqvngfrtlrglgvsgeaeghqlllgnqallneqhvatddmtaeit aqasqgstpvllaidgkaaallavrdplrsdsiaalerlhnagyrlvmltgdnpttanaiakeagidev iagvlpdgkadaikrlqsqgrqvamvgdgindapalaqadvgiamgggsdvaietaaitlmrhslmgva dalaisratlrnmkqnllgafiynsigipvaagilwpftgtllnpvvagaamalssitvvsnanrllrfkpka
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0498
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch