.
The Open Protein Structure Annotation Network
PDB Keyword
.

NYSGXRC-T667

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site YSG
    Status Selected
    Target Id NYSGXRC-T667
    Molecular Characteristics
    Source Thermotoga maritima.
    Alias Ids TPS32312,Q9WZ48 TM0579 Molecular Weight 48831.27 Da.
    Residues 414 Isoelectric Point 9.25
    Sequence mleegehvlvavsggidsmtllyvlrkfspllkikitaahldhriressrrdrefvericrqwnipvets evdvpslwkdsgktleeiarevrydflkrtakkvgaskialahhkndlletvvhrlirgtgplglacis pkreefirpflvfkrseieeyarknnvpyvvdetnynvkytrnfirhrivplmkelnptvedavyrlvs vthllrnfvertvqdfvernvyfykdyavfvepedlflflevtrwvlkemygrvpeyekligtlkskrv elwsgifversfgyvavgktvfkkkyrvevkgdmlemegfkirvvnnrndmkfwvrnrkegdriivngr erklkdvfiekkvptfyrdrvpllvdeedrvlwvpgiarsdflpedvvvelleypvgyvkggtyfeqv
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0579
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch