.
The Open Protein Structure Annotation Network
PDB Keyword
.

ISFI395

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Zygmunt Derewenda
    Status Crystallized
    Target Id ISFI395
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32488, TM0260 Molecular Weight 25924.59 Da.
    Residues 222 Isoelectric Point 5.05
    Sequence mkfiekmlpeespidllinlsrrgeaavvllkdaiedyftgkfgeghlnrvisleresdeiksklkkmyl kmkytyfekddflyivhkadeildvvrdivimldmnrvedvpenikelfaelvenvldtiretteaieq lrtlaesgfspfekekeereifdvsmeerevdtisrnlgkklyslknsmnpvdliflnkvarliskiad qgkditkrinsilr
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0260
    generated 12/2008

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch