The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Zygmunt Derewenda
    Status Purified
    Target Id ISFI396
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32306, TM0493 Molecular Weight 27481.07 Da.
    Residues 229 Isoelectric Point 8.52
    Sequence mdlvfklpvfegpldlllylvrkkkvdireipisqladefveylehmkkldmkitsdflemastlmelks kmliprvreeekesidrkkeelyrrieeyskvkeivsilkkeenllkrkrvrvrnvffekiegiekfre ilkriwkeeamreavhrvksetlsveemmerildeidgeieilrllsraenvyelivrllailelvkig klilvgddrirrytnaaqgry
      BLAST   FFAS

    Ligand Information
    Model TM0493
    generated 12/2008

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch