.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g7q

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 14:52, 18 May 2015 by cawprice with version 17:25, 8 Jun 2016 by adam.
    {{ template.Protein{ leadContact:"", title:"Crystal structure of valine-pyruvate aminotransferase AvtA (NP_462565.1) from Salmonella typhimurium LT2 at 1.80 A resolution. To be published",site:'JCSG', status:'In PDB', date:"2009-02-10", targetid:"391498", pdbid:"3g7q", source:"Salmonella typhimurium lt2", relatedPDBs:[], refids:"NP_462565.1, 3.40.640.10, 325186", molwt:"46582.42", residues:"416", isopoint:"5.74", sequence:"mtfslfgdkftrhsgitrlmedlndglrtpgaimlgggnpahipamqdyfqtlltdmvesgkaadalcn ydgpqgktallnalavllretlgwdiepqnialtngsqsaffylfnlfagrradgstkkvlfplapeyi gyadsgleddlfvsarpniellpegqfkyhvdfehlhigeetgmicvsrptnptgnvitdeelmkldrl anqhniplvidnaygvpfpgiifsearplwnpniilcmslsklglpgsrcgiiiandktitaianmngi islapggmgpammcemikrndllrlsetvikpfyyqrvqqtiaiirrylseerclihkpegaiflwlwf kdlpittellyqrlkargvlmvpghyffpgldkpwphthqcmrmnyvpepdkieagvkilaeeierawreg", method:"XRAY", numchains:"1", resolution:"1.80", rfree:"0.19577", mattcoeff:"2.94", rfactor:"0.17797", waters:"280", solcontent:"58.23", ligands:"", metals:"", model:"False", uniprot:"Q8ZL86", pubmed:"" } }}

    ...

    NP_462565.1 encodes a protein with 416 residues with a conserved domain belong to AAT_I superfamily. Both NCI blast sequence alignment and Dali search results indicate this protein as an aminotranferase. Strong structural similarityThis protein is  a structural homolog to 1B5O and 1X0M is shownsuggested by FFAS and Dali, respectively. JCSG also solved a close homolog from Psychrobacter arcticum 273 http://www.rcsb.org/pdb/explore.do?structureId=3IF2. There is only one subunit of NP_462565.1 in each asymmetric unit. The biomolecule of this target is suggested a dimer by PISA.

    ...

    Figure 3.   Protein NP_462565.1(green) is structuraly similarstructure homolog to 1B5O (Yellow) and 1X0M(Magenta).
     

    ...


    Version from 14:52, 18 May 2015

    This revision modified by cawprice (Ban)
    {{ template.Protein{ leadContact:"", title:"Crystal structure of valine-pyruvate aminotransferase AvtA (NP_462565.1) from Salmonella typhimurium LT2 at 1.80 A resolution. To be published",site:'JCSG', status:'In PDB', date:"2009-02-10", targetid:"391498", pdbid:"3g7q", source:"Salmonella typhimurium lt2", relatedPDBs:[], refids:"NP_462565.1, 3.40.640.10, 325186", molwt:"46582.42", residues:"416", isopoint:"5.74", sequence:"mtfslfgdkftrhsgitrlmedlndglrtpgaimlgggnpahipamqdyfqtlltdmvesgkaadalcn ydgpqgktallnalavllretlgwdiepqnialtngsqsaffylfnlfagrradgstkkvlfplapeyi gyadsgleddlfvsarpniellpegqfkyhvdfehlhigeetgmicvsrptnptgnvitdeelmkldrl anqhniplvidnaygvpfpgiifsearplwnpniilcmslsklglpgsrcgiiiandktitaianmngi islapggmgpammcemikrndllrlsetvikpfyyqrvqqtiaiirrylseerclihkpegaiflwlwf kdlpittellyqrlkargvlmvpghyffpgldkpwphthqcmrmnyvpepdkieagvkilaeeierawreg", method:"XRAY", numchains:"1", resolution:"1.80", rfree:"0.19577", mattcoeff:"2.94", rfactor:"0.17797", waters:"280", solcontent:"58.23", ligands:"", metals:"", model:"False", uniprot:"Q8ZL86", pubmed:"" } }}

    ...

    NP_462565.1 encodes a protein with 416 residues with a conserved domain belong to AAT_I superfamily. Both NCI blast sequence alignment and Dali search results indicate this protein as an aminotranferase. This protein is  a structural homolog to 1B5O and 1X0M suggested by FFAS and Dali, respectively. There is only one subunit of NP_462565.1 in each asymmetric unit. The biomolecule of this target is suggested a dimer by PISA.

    ...

    Figure 3.   Protein NP_462565.1(green) is structure homolog to 1B5O (Yellow) and 1X0M(Magenta).
     

    ...


    Current version

    This revision modified by adam (Ban)
    {{ template.Protein{ leadContact:"", title:"Crystal structure of valine-pyruvate aminotransferase AvtA (NP_462565.1) from Salmonella typhimurium LT2 at 1.80 A resolution. To be published",site:'JCSG', status:'In PDB', date:"2009-02-10", targetid:"391498", pdbid:"3g7q", source:"Salmonella typhimurium lt2", relatedPDBs:[], refids:"NP_462565.1, 3.40.640.10, 325186", molwt:"46582.42", residues:"416", isopoint:"5.74", sequence:"mtfslfgdkftrhsgitrlmedlndglrtpgaimlgggnpahipamqdyfqtlltdmvesgkaadalcn ydgpqgktallnalavllretlgwdiepqnialtngsqsaffylfnlfagrradgstkkvlfplapeyi gyadsgleddlfvsarpniellpegqfkyhvdfehlhigeetgmicvsrptnptgnvitdeelmkldrl anqhniplvidnaygvpfpgiifsearplwnpniilcmslsklglpgsrcgiiiandktitaianmngi islapggmgpammcemikrndllrlsetvikpfyyqrvqqtiaiirrylseerclihkpegaiflwlwf kdlpittellyqrlkargvlmvpghyffpgldkpwphthqcmrmnyvpepdkieagvkilaeeierawreg", method:"XRAY", numchains:"1", resolution:"1.80", rfree:"0.19577", mattcoeff:"2.94", rfactor:"0.17797", waters:"280", solcontent:"58.23", ligands:"", metals:"", model:"False", uniprot:"Q8ZL86", pubmed:"" } }}

    ...

    NP_462565.1 encodes a protein with 416 residues with a conserved domain belong to AAT_I superfamily. Both NCI blast sequence alignment and Dali search results indicate this protein as an aminotranferase. Strong structural similarity to 1B5O and 1X0M is shown by FFAS and Dali, respectively. JCSG also solved a close homolog from Psychrobacter arcticum 273 http://www.rcsb.org/pdb/explore.do?structureId=3IF2. There is only one subunit of NP_462565.1 in each asymmetric unit. The biomolecule of this target is suggested a dimer by PISA.

    ...

    Figure 3.   Protein NP_462565.1(green) is structuraly similar to 1B5O (Yellow) and 1X0M(Magenta).
     

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch