.
The Open Protein Structure Annotation Network
PDB Keyword
.

418974

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 23:33, 9 Dec 2014 by haxelrod with version 23:34, 9 Dec 2014 by haxelrod.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Crystal Structure', date:"2014-10-23", targetid:"418974", pdbid:"", source:"Bacillus subtilis subsp. subtilis str. 168", relatedPDBs:[], refids:"NP_389097.1", molwt:"17727.84", residues:"159", isopoint:"5.47", sequence:"aaqtntlsentnqsaaelvknlyntaykgempqqaqgltinkstkgdvhaafgeperpvggdnrfdlyh wnmgqpgygfsyhkdmtiseiryfgtgverqlnlggvtpevlqkqlgpvnrvltvpftdeidyvydtgr yelhfvigtdqtadhvnlkak", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    The structure

    ...


    Version from 23:33, 9 Dec 2014

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Crystal Structure', date:"2014-10-23", targetid:"418974", pdbid:"", source:"Bacillus subtilis subsp. subtilis str. 168", relatedPDBs:[], refids:"NP_389097.1", molwt:"17727.84", residues:"159", isopoint:"5.47", sequence:"aaqtntlsentnqsaaelvknlyntaykgempqqaqgltinkstkgdvhaafgeperpvggdnrfdlyh wnmgqpgygfsyhkdmtiseiryfgtgverqlnlggvtpevlqkqlgpvnrvltvpftdeidyvydtgr yelhfvigtdqtadhvnlkak", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...

    The structure

    ...


    Current version

    This revision modified by haxelrod (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Crystal Structure', date:"2014-10-23", targetid:"418974", pdbid:"", source:"Bacillus subtilis subsp. subtilis str. 168", relatedPDBs:[], refids:"NP_389097.1", molwt:"17727.84", residues:"159", isopoint:"5.47", sequence:"aaqtntlsentnqsaaelvknlyntaykgempqqaqgltinkstkgdvhaafgeperpvggdnrfdlyh wnmgqpgygfsyhkdmtiseiryfgtgverqlnlggvtpevlqkqlgpvnrvltvpftdeidyvydtgr yelhfvigtdqtadhvnlkak", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch