.
The Open Protein Structure Annotation Network
PDB Keyword
.

429611

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 00:32, 21 Nov 2014 by Admin with version 19:12, 17 Mar 2015 by qxu.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2014-11-13", targetid:"429611", pdbid:"", source:"Homo sapiens", relatedPDBs:[], refids:"BC011707", molwt:"9638.57", residues:"83", isopoint:"9.51", sequence:"megplnlahqqsrradrllaagkyeeaischkkaaaylseamkltqseqahlslelqrdshmkqllliq erwkraqreerlka", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    Crystal structure of MIT domain of NRBF-2, NMR structure was deposited by RIKEN decade ago.

    ...


    Other changes:

    1. /body/h4/@class: "topsan h4 topsanProtein" ⇒ nothing

    Version from 00:32, 21 Nov 2014

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2014-11-13", targetid:"429611", pdbid:"", source:"Homo sapiens", relatedPDBs:[], refids:"BC011707", molwt:"9638.57", residues:"83", isopoint:"9.51", sequence:"megplnlahqqsrradrllaagkyeeaischkkaaaylseamkltqseqahlslelqrdshmkqllliq erwkraqreerlka", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    ...


    Current version

    This revision modified by qxu (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2014-11-13", targetid:"429611", pdbid:"", source:"Homo sapiens", relatedPDBs:[], refids:"BC011707", molwt:"9638.57", residues:"83", isopoint:"9.51", sequence:"megplnlahqqsrradrllaagkyeeaischkkaaaylseamkltqseqahlslelqrdshmkqllliq erwkraqreerlka", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    Crystal structure of MIT domain of NRBF-2, NMR structure was deposited by RIKEN decade ago.

    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch