.
The Open Protein Structure Annotation Network
PDB Keyword
.

430675

    This page can't be edited.
    Table of contents
    to the older version or return to version archive.

    Combined revision comparison

    Comparing version 19:45, 16 Sep 2014 by Admin with version 00:33, 21 Nov 2014 by Admin.
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2014-08-1828", targetid:"430675", pdbid:"", source:"Homo sapiens", relatedPDBs:[], refids:"NP_001001523.1", molwt:"54839.57", residues:"488", isopoint:"8.57", sequence:"qievipckicgdkssgihygvitcegckgffrrsqrcnaaysctrqqncpidrtsrnrcqhcrlqkcla lgmsrdavkfgrmskkqrdslhaevqkqlqqrqqqqqepvvktppagaqgadtltytlglpdgqlplgs spdlpeasacppgllkasgsgpsysnnlakaglngaschleyspergkaegresfystgsqltpdrcgl rfeehrhpglgelgqgpdsygspsfrstpeapyaslteiehlvqsvcksyretcqlrledllrqrsnif sreevtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcray nadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrk veqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplykelfstetes", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    ...


    Version from 19:45, 16 Sep 2014

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2014-08-28", targetid:"430675", pdbid:"", source:"Homo sapiens", relatedPDBs:[], refids:"NP_001001523.1", molwt:"54839.57", residues:"488", isopoint:"8.57", sequence:"qievipckicgdkssgihygvitcegckgffrrsqrcnaaysctrqqncpidrtsrnrcqhcrlqkcla lgmsrdavkfgrmskkqrdslhaevqkqlqqrqqqqqepvvktppagaqgadtltytlglpdgqlplgs spdlpeasacppgllkasgsgpsysnnlakaglngaschleyspergkaegresfystgsqltpdrcgl rfeehrhpglgelgqgpdsygspsfrstpeapyaslteiehlvqsvcksyretcqlrledllrqrsnif sreevtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcray nadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrk veqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplykelfstetes", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    ...


    Current version

    This revision modified by Admin (Ban)
    {{ template.Protein{ leadContact:"", title:"",site:'JCSG', status:'Diffraction-quality Crystals', date:"2014-08-18", targetid:"430675", pdbid:"", source:"Homo sapiens", relatedPDBs:[], refids:"NP_001001523.1", molwt:"54839.57", residues:"488", isopoint:"8.57", sequence:"qievipckicgdkssgihygvitcegckgffrrsqrcnaaysctrqqncpidrtsrnrcqhcrlqkcla lgmsrdavkfgrmskkqrdslhaevqkqlqqrqqqqqepvvktppagaqgadtltytlglpdgqlplgs spdlpeasacppgllkasgsgpsysnnlakaglngaschleyspergkaegresfystgsqltpdrcgl rfeehrhpglgelgqgpdsygspsfrstpeapyaslteiehlvqsvcksyretcqlrledllrqrsnif sreevtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcray nadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrk veqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplykelfstetes", method:"", numchains:"", resolution:"", rfree:"", mattcoeff:"", rfactor:"", waters:"", solcontent:"", ligands:"", metals:"", model:"False", uniprot:"", pubmed:"" } }}

    ...


    ...


    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch